Complet list of 3bmc hssp fileClick here to see the 3D structure Complete list of 3bmc.hssp file
HSSP       HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 2.0 2011
PDBID      3BMC
THRESHOLD  according to: t(L)=(290.15 * L ** -0.562) + 5
REFERENCE  Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
CONTACT    Maintained at http://www.cmbi.ru.nl/ by Maarten L. Hekkelman 
DATE       file generated on 2013-09-26
HEADER     pteridine reductase, ptr1, trypanosoma  2008-12-16 3BMC
COMPND     Pteridine reductase; Pteridine reductase
SOURCE     Trypanosoma brucei brucei; Trypanosoma brucei brucei
AUTHOR     Tulloch, L.B.; Hunter, W.N.
SEQLENGTH   249
NCHAIN        4 chain(s) in 3BMC data set
KCHAIN        1 chain(s) used here ; chains(s) : A
NALIGN       45
NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein
NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken
NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry
NOTATION : %IDE: percentage of residue identity of the alignment
NOTATION : %SIM (%WSIM):  (weighted) similarity of the alignment
NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence
NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein
NOTATION : LALI: length of the alignment excluding insertions and deletions
NOTATION : NGAP: number of insertions and deletions in the alignment
NOTATION : LGAP: total length of all insertions and deletions
NOTATION : LSEQ2: length of the entire sequence of the aligned protein
NOTATION : ACCNUM: SwissProt accession number
NOTATION : PROTEIN: one-line description of aligned protein
NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary
NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983)
NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments
NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of insertion in this sequence
NOTATION : dots (....) in the alignend sequence indicate points of deletion in this sequence
NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their
NOTATION : acid/amide form in proportion to their database frequencies
NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence)
NOTATION : NDEL: number of sequences with a deletion in the test protein at this position
NOTATION : NINS: number of sequences with an insertion in the test protein at this position
NOTATION : ENTROPY: entropy measure of sequence variability at this position
NOTATION : RELENT: relative entropy, i.e.  entropy normalized to the range 0-100
NOTATION : WEIGHT: conservation weight

## PROTEINS : identifier and alignment statistics
  NR.    ID         STRID   %IDE %WSIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCNUM     PROTEIN
    1 : Q9GU98_TRYCR        0.55  0.75    1  251   10  276  267    2   18  276  Q9GU98     Pteridine reductase OS=Trypanosoma cruzi PE=3 SV=1
    2 : PTR1_LEIMA  1W0C    0.47  0.65    3  251    7  288  282    4   35  288  Q01782     Pteridine reductase 1 OS=Leishmania major GN=PTR1 PE=1 SV=2
    3 : Q2PPA2_LEITR        0.46  0.65    3  251    7  288  282    4   35  288  Q2PPA2     Pteridine reductase 1 OS=Leishmania tropica GN=PTR1 PE=4 SV=1
    4 : K0CKX4_ALTME        0.43  0.65    3  248    6  243  247    8   12  249  K0CKX4     Pteridine reductase OS=Alteromonas macleodii (strain English Channel 673) GN=AMEC673_07350 PE=4 SV=1
    5 : I2JGG1_9GAMM        0.38  0.59    3  249    7  248  249    6   11  249  I2JGG1     Pteridine reductase OS=gamma proteobacterium BDW918 GN=DOK_16708 PE=3 SV=1
    6 : B3PKA9_CELJU        0.37  0.61    2  249    6  247  249    5   10  248  B3PKA9     Oxidoreductase, short chain dehydrogenase/reductase family OS=Cellvibrio japonicus (strain Ueda107) GN=CJA_0772 PE=4 SV=1
    7 : Q2BK08_NEPCE        0.37  0.58    5  248    8  243  245    6   12  246  Q2BK08     Pteridine reductase OS=Neptuniibacter caesariensis GN=MED92_16585 PE=3 SV=1
    8 : I7HU70_LEGPN        0.36  0.54    1  249    8  250  250    5   10  251  I7HU70     Pteridine reductase OS=Legionella pneumophila subsp. pneumophila GN=phaB PE=4 SV=1
    9 : R0FVP8_9XANT        0.35  0.53    4  249    7  245  247    6   11  245  R0FVP8     Pteridine reductase OS=Xanthomonas fragariae LMG 25863 GN=O1K_06002 PE=4 SV=1
   10 : H8KZK4_FRAAD        0.34  0.62    1  248    6  245  248    6   10  247  H8KZK4     Putative uncharacterized protein OS=Frateuria aurantia (strain ATCC 33424 / DSM 6220 / NBRC 3245 / NCIMB 13370) GN=Fraau_2722 PE=3 SV=1
   11 : Q3BXN4_XANC5        0.34  0.52    2  249    5  245  249    5   11  245  Q3BXN4     Pteridine reductase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=XCV0748 PE=4 SV=1
   12 : A0P420_9RHOB        0.33  0.55    1  248    3  242  250    8   14  251  A0P420     Short chain dehydrogenase OS=Labrenzia aggregata IAM 12614 GN=SIAM614_28573 PE=4 SV=1
   13 : B2I9Z3_XYLF2        0.33  0.54    2  249    5  245  249    5   11  245  B2I9Z3     Short-chain dehydrogenase/reductase SDR OS=Xylella fastidiosa (strain M23) GN=XfasM23_0711 PE=3 SV=1
   14 : E6WP91_PSEUU        0.33  0.55    3  247    6  244  247    6   12  245  E6WP91     Short-chain dehydrogenase/reductase SDR OS=Pseudoxanthomonas suwonensis (strain 11-1) GN=Psesu_0202 PE=3 SV=1
   15 : F1XAA9_MORCA        0.33  0.52    5  249    5  251  249    5    8  255  F1XAA9     Pteridine reductase OS=Moraxella catarrhalis CO72 GN=E9W_04158 PE=4 SV=1
   16 : H1XC10_9XANT        0.33  0.52    2  249    5  245  249    5   11  245  H1XC10     Short chain dehydrogenase family protein OS=Xanthomonas axonopodis pv. punicae str. LMG 859 GN=fabG1 PE=4 SV=1
   17 : K6GGK2_9GAMM        0.33  0.56    2  248    2  241  248    6   11  241  K6GGK2     KR domain protein OS=SAR86 cluster bacterium SAR86E GN=B273_0749 PE=3 SV=1
   18 : L7HHX6_XANCT        0.33  0.56    1  249    3  244  250    5   11  244  L7HHX6     Pteridine reductase OS=Xanthomonas translucens DAR61454 GN=A989_00620 PE=3 SV=1
   19 : M4TTQ9_9XANT        0.33  0.52    2  249    5  245  249    5   11  245  M4TTQ9     Pteridine reductase OS=Xanthomonas axonopodis Xac29-1 GN=XAC29_03495 PE=4 SV=1
   20 : Q87DK5_XYLFT        0.33  0.54    2  249    5  245  249    5   11  245  Q87DK5     Pteridine reductase 1 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ptr1 PE=3 SV=1
   21 : Q8PPJ9_XANAC        0.33  0.52    2  249    5  245  249    5   11  245  Q8PPJ9     Pteridine reductase 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ptr1 PE=4 SV=1
   22 : Q9PDC2_XYLFA        0.33  0.55    2  249    5  245  249    5   11  245  Q9PDC2     Pteridine reductase 1 OS=Xylella fastidiosa (strain 9a5c) GN=XF_1457 PE=3 SV=1
   23 : A6EZE0_9ALTE        0.32  0.49    1  248    4  246  249    4    9  248  A6EZE0     Dehydrogenase/reductase OS=Marinobacter algicola DG893 GN=MDG893_03660 PE=3 SV=1
   24 : B8ER17_METSB        0.32  0.51    1  251    9  252  254    6   15  258  B8ER17     Short-chain dehydrogenase/reductase SDR OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=Msil_0792 PE=4 SV=1
   25 : C3XQ96_BRAFL        0.32  0.53    3  250   13  253  249    5   11  253  C3XQ96     Uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_130700 PE=3 SV=1
   26 : Q82VC9_NITEU        0.32  0.55    3  248    4  244  247    4    9  246  Q82VC9     Short-chain dehydrogenase/reductase (SDR) superfamily OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=NE1165 PE=3 SV=1
   27 : C1DAU6_LARHH        0.31  0.56    2  249    6  248  249    4    9  249  C1DAU6     Probable pteridine reductase OS=Laribacter hongkongensis (strain HLHK9) GN=LHK_00282 PE=3 SV=1
   28 : C6X8M5_METSD        0.31  0.56    1  248    6  248  249    4    9  250  C6X8M5     Short-chain dehydrogenase/reductase SDR OS=Methylovorus sp. (strain SIP3-4) GN=Msip34_0246 PE=4 SV=1
   29 : D9W4A6_9ACTO        0.31  0.53    1  246   13  255  252    6   17  274  D9W4A6     2-deoxy-D-gluconate 3-dehydrogenase OS=Streptomyces sp. C GN=SSNG_06986 PE=3 SV=1
   30 : G4SUG1_META2        0.31  0.55    5  248    5  241  245    5   11  243  G4SUG1     Short-chain dehydrogenase/reductase SDR OS=Methylomicrobium alcaliphilum (strain DSM 19304 / NCIMB 14124 / VKM B-2133 / 20Z) GN=MEALZ_0083 PE=4 SV=1
   31 : G6YMS5_9ALTE        0.31  0.51    1  248    4  246  249    4    9  248  G6YMS5     Short-chain dehydrogenase/reductase SDR OS=Marinobacter manganoxydans MnI7-9 GN=KYE_00629 PE=3 SV=1
   32 : H5SD79_9GAMM        0.31  0.54    3  248    4  242  247    5   11  242  H5SD79     Short-chain dehydrogenase/reductase OS=uncultured gamma proteobacterium GN=HGMM_F12G10C21 PE=3 SV=1
   33 : Q2YC77_NITMU        0.31  0.53    1  248    2  244  249    4    9  246  Q2YC77     Short-chain dehydrogenase/reductase SDR OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=Nmul_A0336 PE=3 SV=1
   34 : S2UFI2_9GAMM        0.31  0.56    6  249    2  237  245    5   12  237  S2UFI2     Pteridine reductase 1-like protein OS=Cycloclasticus sp. PY97M GN=L196_05950 PE=4 SV=1
   35 : A9DMP2_9GAMM        0.30  0.53    6  247    6  236  243    7   15  243  A9DMP2     Pteridine reductase OS=Shewanella benthica KT99 GN=KT99_11821 PE=4 SV=1
   36 : B3PV85_RHIE6        0.30  0.48    5  250    9  245  248    7   15  255  B3PV85     Probable 3-oxoacyl-[acyl-carrier-protein] reductase protein OS=Rhizobium etli (strain CIAT 652) GN=RHECIAT_CH0001548 PE=3 SV=1
   37 : F0IZ30_ACIMA        0.30  0.50    5  250    9  244  247    7   14  254  F0IZ30     Putative oxidoreductase OS=Acidiphilium multivorum (strain DSM 11245 / JCM 8867 / AIU301) GN=ACMV_16930 PE=3 SV=1
   38 : F1YUE5_9PROT        0.30  0.53    2  251   21  263  253    8   15  274  F1YUE5     Glucose 1-dehydrogenase 2 OS=Acetobacter pomorum DM001 GN=gdhII PE=3 SV=1
   39 : F7UV36_EEGSY        0.30  0.55    5  248   12  254  249    6   13  254  F7UV36     Dehydrogenase with different specificity OS=Eggerthella sp. (strain YY7918) GN=FabG PE=3 SV=1
   40 : G4E566_9GAMM        0.30  0.55    3  248    9  247  247    5   11  247  G4E566     3-oxoacyl-(Acyl-carrier-protein) reductase OS=Thiorhodospira sibirica ATCC 700588 GN=ThisiDRAFT_1445 PE=4 SV=1
   41 : G9YAF4_HAFAL        0.30  0.51    1  246    5  252  254    6   16  252  G9YAF4     Oxidoreductase, short chain dehydrogenase/reductase family protein OS=Hafnia alvei ATCC 51873 GN=HMPREF0454_03578 PE=3 SV=1
   42 : I0QQB2_9ENTR        0.30  0.51    3  246    3  248  252    7   16  248  I0QQB2     Putative NAD(P)-binding oxidoreductase OS=Serratia sp. M24T3 GN=SPM24T3_16568 PE=3 SV=1
   43 : J5QH24_9RHIZ        0.30  0.48    5  250    9  245  248    7   15  255  J5QH24     Short chain dehydrogenase OS=Rhizobium sp. CCGE 510 GN=RCCGE510_01175 PE=3 SV=1
   44 : R1F2R0_9GAMM        0.30  0.49    2  246    2  248  253    7   16  248  R1F2R0     Short chain dehydrogenase/reductase family oxidoreductase OS=Aeromonas molluscorum 848 GN=G113_15363 PE=3 SV=1
   45 : S0H244_STRA9        0.30  0.49    1  245    9  246  249    6   17  250  S0H244     3-oxoacyl-[acyl-carrier protein] reductase OS=Streptomyces albulus CCRC 11814 GN=K530_21111 PE=4 SV=1
## ALIGNMENTS    1 -   45
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1    2 A E              0   0  174   14   65  E      E E N     E    SK   NT T Q       S   D
     2    3 A A        -     0   0   32   26   65  C    A A ASDS  SNTSSSSTA  TDP T G    P  S  SG
     3    4 A P        -     0   0   36   36   53  PPPPPP K PKRKP KKKKKKKPPPKPKA PKK    R KPK KK
     4    5 A A  E     -a   28   0A   0   37   35  AVVVVV VVVVIVV VTVVVVVVAVVVVT VVV    R TVV VV
     5    6 A A  E     -ab  29  88A   0   44   40  AAAAAAAAVAVAAVAVIAVAVAVAAIVVAVAAI  AAAAVAAAAA
     6    7 A V  E     -ab  30  89A   0   46   11  ILLLLLLLLLLLLLLLLLLLLLLLMLLLVLLLLLLLLLVLLLLLV
     7    8 A V  E     -ab  31  90A   0   46   13  IVVIVVIVIVIVIVIIIIIIIIIVVVIIVIIIVIVIVVVIVVVII
     8    9 A T  S    S+     0   0    2   46    0  TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
     9   10 A G  S    S+     0   0   23   46    0  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
    10   11 A A        +     0   0    0   46   33  GAAAGAAGAAAAGAGAASAGAGAGSGAGSGAGGAAAGGSGAGAAA
    11   12 A A  S    S+     0   0    7   46   33  AAAAAAAAGGAGAAAAAAAAAAAGSAAADAAVAAAAAGSASSASG
    12   13 A K  S >> S+     0   0  112   46   44  RKKKQKKKRQRKRRKRKRRRRRHRQRRKSKHVRRKKKARRRRKRR
    13   14 A R  H 3> S-     0   0   77   46   32  RRRRRRRRRRRRRRRRRRRRRRRRRRRRGRRRRRRRRRGRGGRGG
    14   15 A I  H 3> S+     0   0   25   46   22  ILLIIIIIIIILIIIIIIIIIILILVIVIILIVIIILLIIIIIIQ
    15   16 A G  H <> S+     0   0    1   46    0  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
    16   17 A R  H  X S+     0   0   72   46   65  HRSAAAAAATAKKAAARAAKAKALAAAARAAAAARRARRARRRAA
    17   18 A A  H  X S+     0   0   21   46   56  SSSAEEKAQAQAAAAQEGQAQAHACAGSAAQAAQEAAAAQAAAAT
    18   19 A I  H  X S+     0   0    0   46   41  IIIMIILIIIIIIIIIMIIIIITITIIIVCTITMIIIIVITTITE
    19   20 A A  H  X S+     0   0    0   46   40  AAAACATVAAAAVATAAAAVAVAAVCACAAAACTAAVAASAAAAA
    20   21 A V  H  X S+     0   0   27   46   84  VEECRREKTRTRHRNTLRTHTHRCKRRRVKRERKIERLERLIERR
    21   22 A K  H  X S+     0   0   27   46   91  RGGQQHAKTHTGHRLTSRTHTHHRHWHLRLTVRTKDSGKYLLDLL
    22   23 A L  H  X>S+     0   0    0   46    2  LLLLLLLLLLLLLLLLFLLLLLLLLLLLLLLLLFLLLLLLLLLLF
    23   24 A H  H ><5S+     0   0    3   46   53  HHHHHHHHHHHAHHHHFHHHHHHAHHHHAHHHHHHASAAHAAAAV
    24   25 A Q  H 3<5S+     0   0  135   46   68  QAASSNQLAQADAAQANAAAAAQRQRAASEERSASAQQAHKEAQA
    25   26 A T  H 3<5S-     0   0   85   46   74  QEEERASSAAAQHAHAKAAHAHRAAKRGASREQASHAAAARQNQC
    26   27 A G  T <<5S+     0   0   23   46    0  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
    27   28 A Y      < -     0   0   21   46   34  FYYYYYYYYYYYYHFYWYYYYYWYYALALFWFAYYFFFFLYYFYA
    28   29 A R  E     -a    4   0A  35   46   75  RAARRNDQRRRARDNCDRCRCRNANRNKDNNNNGNSPDDNRRSRR
    29   30 A V  E     -ac   5  55A   0   46   21  VVVVVLVVVIVMVLVVVVVVVVLVVLLLVILLLVVVVVVIIVVLV
    30   31 A V  E     -ac   6  56A   0   46   63  VCCIIIAAAAAGAAIAVAAAAAVAIVMMGLVVAVIAVACACAACV
    31   32 A I  E     -ac   7  57A   0   46   27  VLLIIVIILVLLVLILILLVLVIIIVLIILILVVIIIIVLIVILL
    32   33 A H  E     + c   0  58A   3   46   22  HHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHNHNNHNG
    33   34 A Y  E     - c   0  59A  33   46   56  YYYYYYYCAYAYACYAFAAAAAYCYYYYWYYYYYYAHYCYYYAYD
    34   35 A H  S    S-     0   0   76   46   72  RHHGRHRHHRHNHHHYNHHHHHRSRRRRHRRLRRGNRRSRCLNLV
    35   36 A N  S    S+     0   0  135   46   77  HRRHHQSSRRRSQGTRNTRQRQSPKDQSESTSSHAGASSGQNGRR
    36   37 A S     >  +     0   0   36   46   37  SSSSSSAASSSSSSSSSSSSSSRSSSSSDSRSSSSSSGESDNSEE
    37   38 A A  H  > S+     0   0   39   46   73  EAAKSAALGAAAGLQAEQAGAGESQSAAEEEEIRALSQRAHAIAE
    38   39 A E  H  > S+     0   0  179   46   68  GAADAATHDAEEHAAEDTEHEHALAAASESERESEGGEgARQGAE
    39   40 A A  H  > S+     0   0   30   46   60  AEEEAAEEASVGEEEVDEVEVEDAPDEEGSQAEEEEEDdAAAERG
    40   41 A A  H  X S+     0   0    0   46   44  AAAAAAAALALALMALALLLLLAEAAAAAAAAAAAAAAAAAAAAR
    41   42 A V  H  X S+     0   0   61   46   69  QNNLEDQDGRDQHEDDKQDHDHNAEQSRRRNVQDSEEQQERQEEA
    42   43 A S  H  X S+     0   0   66   46   72  RATAQEEIAQAEAAKAVAAAAAAEERMARQSATESEAEAASKDAL
    43   44 A L  H  X S+     0   0    0   46   42  LLLLLLLLRLRLFLLRLLRFRFLRLLLLTLLLLLLLLTLLLVLLV
    44   45 A A  H  X S+     0   0    6   46   70  VSAARVAAVAVHLASVAAVLVLREAKAQACIKQVCAAAAAAVAAA
    45   46 A D  H  X S+     0   0  101   46   65  AAAEDQDKTAADTAHADQATATDAQQDSEDATAQHAAADVDNAEE
    46   47 A E  H  X S+     0   0  101   46   54  ETTKAQRHEEEEEATEEEEEEEEESEDEELQRELAEEAEEEEEEL
    47   48 A L  H  X S+     0   0    8   45   23  LLLLLLLLLLLILLLLMLLLLLLKLLLLVLMLLLLLLILLII.LG
    48   49 A N  H  < S+     0   0   44   46   70  NNNNNNNNCECIEENCNECECENINENNrNNENNNRRNANETLSD
    49   50 A K  H  < S+     0   0  196   42   75  AAASDQQQMAAARSQGSAARARSISQRLgDRARNQ.A.AAA.R.A
    50   51 A E  H  < S+     0   0  147   46   82  ARRQLLKVQAQETAIQQAQTQTIHVGLQRIQETKIRQAAQLAQAA
    51   52 A R  S >< S-     0   0   84   46   35  RRRRRRRRRRRGRRRRRRRRRRRERHRRRRRRRRRKGCHRGRKRR
    52   53 A S  T 3  S+     0   0   96   46   64  APPEAPPMAPAGPPPADAAPAPPGPPPPALPPSEEAGGGPTGGGF
    53   54 A N  T 3  S+     0   0  141   45   71  GNNDDDNNGAGKSGNGGGGSGSKGNDGNVDDDGHDC.QVDESYAV
    54   55 A T    <   +     0   0   10   46   51  SSSSSSSSSSSAISSSSSSISSSRSSSSSSSSSSSRVKRSTQRER
    55   56 A A  E     +c   29   0A   6   46   47  AAAAAAAAASAATVAAATATATAAAVAVAAAVVACAASAVLAAIH
    56   57 A V  E     -c   30   0A  49   46   85  VIITTLKIQLHLLLTHILHLHLVSTAAARQCRAWIVHCIALIILD
    57   58 A V  E     -c   31   0A  52   46   65  LTTCAATVALALAVTAITAAAAAATLTILTALLATAVLAIAAATV
    58   59 A C  E     -c   32   0A  10   46   61  CVVLMVFLFLLQLLLLVLLLLLILLLHIDILVVIALLLKFCILVT
    59   60 A Q  E     +c   33   0A 103   45   68  KQQQAQSQHQH.LQCHQHHLHLQGQQQQLKQAQKQKAQARAQEQD
    60   61 A A        -     0   0    8   46   24  GAAAAAAKAAAKGAAAAAAGAGAAAAAATAAAAAAAAAAANAAAA
    61   62 A D        -     0   0   69   46   18  DDDNDHDEDDDDDDNDNDDDDDDDDDDDDDDDDDDDDDNDIDDDD
    62   63 A L        +     0   0    6   46   16  LLLLMLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVLAILLG
    63   64 A T  S    S-     0   0   28   46   88  SSSCTGNTRARSHQDRDRRHRHASCLLLPASRLQSTAAACDATAW
    64   65 A N        +     0   0   28   46   78  LnnNSNNELDLREDILNDLELEADKDDNAVQQDSIDDRNAEDDER
    65   66 A S  S >  S-     0   0   51    4   71  Gpp..........................................
    66   67 A N  T 3  S+     0   0  120    6   85  SVV...........I.........G....................
    67   68 A V  T 3> S+     0   0   86    6   95  STT...........H.........D....................
    68   69 A L  H <> S+     0   0    0    6   77  LLL...........H.........T....................
    69   70 A P  H  > S+     0   0   19   42   89  LFFSFQLPTIPPNPQPVAPNPNPAETCI.KLVIV.IPESL.EIE.
    70   71 A A  H  > S+     0   0   55   44   62  DTKDAEEGHGDEAAEDDADADADAKGGA.ATSAQEGAEANSQGS.
    71   72 A S  H  X S+     0   0   33   44   74  CRREEAQAAAATVAQAEQAVAVQAMGQV.EGARKEEAGEEAQEE.
    72   73 A C  H  X S+     0   0    0   45   77  CCCVVLLAPLPAPPLPILPPPPTVAILLALVLLIGTVVALVVTV.
    73   74 A E  H  X S+     0   0  105   45   77  EAASQQNEAPAGEGSAKPAEAEEDKPPPALDAPEISEEQHCVSV.
    74   75 A E  H  X S+     0   0   82   46   73  DEGAAQQEQAQETQEQKAQTQMLQEAASDLRRQQNESPAAEAART
    75   76 A I  H  X S+     0   0    0   46   23  ILLLLLLILRLLLLFLLLLLLLLLLLLLVLLLLMDLLLLLMMLLV
    76   77 A I  H  X S+     0   0    0   46   51  IVVGAAAIVVVIIVSVAVVIVIAIIVVIIAAVVVLIIVIAFFVFV
    77   78 A N  H  X S+     0   0   42   46   74  DAAQKHESAKAGARKAKTAAAARPIDDQDDSKADVKAQDADTRQD
    78   79 A S  H  X S+     0   0   10   46   84  CAARNTDKDADDRQLGIQGRGRKRAQAERYDEEQKRRQAALQKTT
    79   80 A C  H  X S+     0   0    0   46   68  SCCAASIVCVCACCCCTCCCCCAAAATTLAAATVVAAAAVIIALA
    80   81 A F  H  X S+     0   0   32   46   80  FYYLLILKIIVAAIILLVLALAVGVALIAKIAVIASESYVDASDV
    81   82 A R  H  < S+     0   0  162   46   74  RTTGGHRHADAAGDAAEQAGAGSAEREKGTAAETTEAAEQQRERT
    82   83 A A  H  < S+     0   0   46   46   80  AHHIVAHWAGAAHHQAKHAHAHTAKQQQEAQVRRSELAAHREARA
    83   84 A F  H  < S-     0   0    9   46   38  FWWWWWFAFFFLFHFFNFFFFFWFWFFFLWWWFHFLALFFLLIFF
    84   85 A G  S  < S+     0   0   56   46   15  GGGGQQGGGGGgGGGGQGGGGGGGGGGGGGGGGGKGGgGGGGGGG
    85   86 A R        -     0   0   66   45   45  RRRQRRQRRRRpRRRRRRRRRRRARRRKRGRRKR.PPpRGRPHSR
    86   87 A C        +     0   0    0   46   40  CCCIVLLLLLLVLLILILLLLLLLLLLLLILLLLLIILIVILLLL
    87   88 A D        +     0   0    9   46   23  DDDNDDNDDDDSDDDDDDDDDDDSDDDDDDDDDDSDGGDDDTDDD
    88   89 A V  E     -bd   5 138A   0   46   60  VVVVVLLLGLGVVGAGAAGVGVGLVAYVVAAAAVILVVVVAALAV
    89   90 A L  E     -bd   6 139A   0   46    8  LLLLLLLLVLVLLLLVLLVLVLLLLLLLLLLLLLLLLLLLLLLLL
    90   91 A V  E     -bd   7 140A   0   46    9  VVVVVVIVVVVVIVIVIVVIVIVVVVVIVVVVVIIVVVVIVVVVV
    91   92 A N  E     + d   0 141A   5   46    3  NNNNNNNNNNNNNNHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    92   93 A N        +     0   0   26   46    3  NNNNNNNNNNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    93   94 A A        +     0   0   18   46    0  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
    94   95 A S        -     0   0   31   46   19  SSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSASSSGSGGSGA
    95   96 A A        -     0   0   20   46   78  ASSSGSTVAAAANSSATTANANVTDSSSTSVRSTEIRTITIIVIL
    96   97 A F        +     0   0   33   46   17  YFFFFFFFFFFFFFFFFFFFFFFFFFFYGFFFFFFFFFTFLLFLW
    97   98 A Y        -     0   0   39   46   61  YYYYYYYKYYYSYFYYYYYYYYYEFFFYTYYYFYYREERYHFRLR
    98   99 A P        -     0   0   45   46   47  PPPPPPPRPPSTPPPPPPPPPPPRPPPAAPPPPPPQFRDPTTQPT
    99  100 A T        -     0   0    2   46   45  TTTTTTTTTTTDTTSTTTTTTTNDTTTTTTTTTTTDDDGTQQDQA
   100  101 A P        -     0   0   63   46   53  pppPPPPDAPASPPdAPPAPAPPSPPPEPGPPPPPSSELRSSSSP
   101  102 A L              0   0    0    8   89  agg...........d.........................TT.R.
   102  103 A V              0   0   74   46   69  DDDVILICLLILLLTIVLILILTPMVVLFITLFVLAAWALIIAVV
   103      ! !              0   0    0    0    0  
   104  113 A G              0   0  133   46   67  ARRGDGEHGGGSGGHGDAGGGGQAGGGGLGAEGGARAHVGEERED
   105  114 A K        -     0   0  106   46   62  KEEEEQEFKQEDEQQETEEEEEDDTDRQDQDEEDKSSNREGNSDQ
   106  115 A T    >>  -     0   0   68   46   73  PAAIAVTLAIALVATAFAAVAVAFVCIILVAAIATFVVMILLFLE
   107  116 A V  H 3> S+     0   0   30   46   68  IMMSTDSNTSTTTGLTSTTTTTSTDTDSDSTTTNQDTTKSTTDDT
   108  117 A E  H 3> S+     0   0   73   46   72  DEEEEELEPEAIPPLAEPAPAPPLGEEELEEEAEFAARESAAAAE
   109  118 A T  H <> S+     0   0   52   46   59  ATADAAHAATADAAKAAAAAAAGDDQADAHDEDSDEGEEAEETAE
   110  119 A Q  H  X S+     0   0   40   46   69  QAADDTQDQAQTQQHQDQQQQQDQQASAGDDHMEDASSDHRRARN
   111  120 A V  H  X>S+     0   0    4   46   58  VTAWWWWWWWWWWWWWWWWWWWWWWWWWVWWWWWCWIWFWIIWIF
   112  121 A A  H  X5S+     0   0   14   46   64  AAAVDDDQDDDQDDDDIDDDDDDEKHATRDNEDNQAAMDENNANA
   113  122 A E  H  X5S+     0   0   40   46   73  EDDSADEYEDEFDANDADDDDDARTDDDRETEDDRQAAADLQQRL
   114  123 A L  H  X5S+     0   0    0   46   38  LLLLLLLLLVLLLLLLLLLLLLINVLLLILILLLLHHHVLIVHLL
   115  124 A I  H  X>S+     0   0    7   46   34  FFFIMLIFFFFIFFFFMFFFFFMFMVIVLILLMMLFMLILLMFLM
   116  125 A G  I   S+     0   0    4   46   19  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPTYPQP
   123  132 A F  H  X S+     0   0    1   46   33  LYYLFFYFFLFVFFLFLLFFFFFCFLLLLFFFLFYSVFFLFFSFF
   124  133 A L  H  X S+     0   0    5   46   25  FFFFFFFLFFFFFFLFFFFFFFFVFFWFLFFFFFFILVNFLLILL
   125  134 A L  H  X S+     0   0    1   46   47  LLLLLLLLILILLLLILLILILLLLLLLCLLLLVLLLLCLCCLCG
   126  135 A T  H  X S+     0   0    0   46   69  IIISSACSAAAMAASAIAAAAAGASSASGTLSSSAAAMCACCVCI
   127  136 A M  H  X S+     0   0   35   46   47  RKKQQQAMQQQQQQHQQQQQQQQRQQQQQQQQQKQARQKQRRARQ
   128  137 A S  H  X S+     0   0   12   46   45  AAAAASTAAAAAAAAAAAAAAAARAAAARAGAAVKADHAAEEAEA
   129  138 A F  H  X S+     0   0    0   46   70  FFFLLLLAAAAFAALAFAAAAACFAVAAALCAAALFMFALAAFAA
   130  139 A A  H >< S+     0   0   11   46   57  AAAAAASCAAAATALAKAATATLAIAAAAILFAFSAAAAAVVAVV
   131  140 A Q  H 3< S+     0   0  117   46   68  RHHPPEKPAPASPPPAEAAPAPPEPPPPRKAPSKPEAKQPKKERP
   132  141 A R  H 3<        0   0  105   46   84  RrraAKTLQwQqLHAQEQQLQLAtHYHEHEEEQALQRARVRVQRA
   133  142 A Q    <<        0   0  102    7   71  Qaaa.....k.p.................................
   134      ! !              0   0    0    0    0  
   135  152 A S              0   0  137   45   33  ggdvlllllalllllllllllll.llllmlllllllilmlmmlml
   136  153 A N        -     0   0   36   46   76  nnnkaqnkrrrgrghrkrrrrrqnkrnsgrrghkntqqyhggngg
   137  154 A L  E     + e   0 180A  18   46   26  LYYGGGGGGGGGGGGGGGGGGGGAGGGGGGGGGGGGGGGGGGGGG
   138  155 A S  E     -de  88 181A   0   46   71  SSSCCACSASAAAACAFAAAAAASCCACRCSACCTLVMRCAGLAS
   139  156 A I  E     -de  89 182A   0   46    7  AIIIIIIIIIIIIIIIIIIIIIIIIIIIIVVIIIIIIVIIIIIII
   140  157 A V  E     -de  90 183A   0   46   12  VIVIIIIIVVVVIVVVIVVIVIVVIVVIVVVVVVIVVLVVVVVVV
   141  158 A N  E     -de  91 184A   0   46    6  NNNNNNNNNNNNNNSNNNNNNNNNNNGNNNNNNNNNNNNNNNNNN
   142  159 A L  E     + e   0 185A   7   46   30  LMMMLIMILLLMLLLLFILLLLLIMIIIVILLIILILMMIVVIVI
   143  160 A C        -     0   0    7   46   70  CVVVVAITTTTLTALTTTTTTTIIAIVTTTIIVVLILLAVSSISS
   144  161 A D    >   -     0   0   12   46   23  DDDDDDDDDDDDDDDDDDDDDDDDDDDDSDDDDDDDDDSDSSDSS
   145  162 A A  T 3  S+     0   0    9   46   68  AAAMIIIILILTLLILILLLLLIQIIIMVIIVIIIQQEVIAAQAT
   146  163 A M  T >   +     0   0   13   46   74  MMMHYYHHHYHQHYHHNHHHHHYRHHHHHHYYHYHRKRVHAARAA
   147  164 A V  T <  S+     0   0   17   46   65  TTTIAAASAAAMGAAAVAAGAGSVGTIVEASASAGVLVGAASVAG
   148  165 A D  T 3  S+     0   0   68   46   84  DNNDKEQDQEQLTGdQDEQTQTQLQEDEHEEYEKQWAWVLrrWrL
   149  166 A Q  S <  S-     0   0   15   46   71  LQQRNRRKQRQSQTkQKQQQQQRRRQRRQRRRWRKANSSKggAgR
   150  167 A P        -     0   0    7   46   54  PPPPPPGPPGPAPPPPAPPPPPPLPPPPPGPPPSPLLLGPSALSG
   151  168 A X    >   -     0   0   47   46   68  LLLLLLLLMLMSLLFMFLMLMLLTLLMKRLIRLLLNNTNLPPNPI
   152  169 A M  T 3  S+     0   0   84   46   82  PLLPPQPKRARPRRIRTRRRRRAPAKPKVKDLKVKPPPAKFGPHP
   153  170 A A  T 3  S+     0   0   17   46   59  GGGKSNGGNDNEQDGNNANQNRDQGRDGGGDSNDDGDHGDEEGEG
   154  171 A F    <>  +     0   0   10   46   56  FYYHHHYYHHHRHHYHHHHHHHHFYYHYSYHYYYHFFFQYYYFYH
   155  172 A S  H  >  +     0   0    0   46   81  CTTSSSPSPPPFAPPPSSPAPAPFSVAIGPPPVPGYFVAALIYVS
   156  173 A L  H  > S+     0   0    0   46   67  VIIVIVIVLVLSVLILILLVLVLSVIVVPVLIVIISASNVDDSDA
   157  174 A Y  H  > S+     0   0    7   46    0  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY
   158  175 A N  H  X S+     0   0    2   46   73  TTTLCCSCGVGFTSNGLSGTGTCTCNSSCSCSNSSTTTASAATAG
   159  176 A M  H  X S+     0   0    1   46   65  MMMIMIIQAMACAAMAAAAAAAALIAAVAIAVATILLVAIAALAA
   160  177 A G  H  X S+     0   0    0   46   43  AAAAAAATSASGAAASAASASASSAAAAAATSAASSSSSASSSSS
   161  178 A K  H  X S+     0   0    7   46    0  KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK
   162  179 A H  H  X S+     0   0    7   46   52  HGGSAAAASASFAAASSASASASAAGAAGAAAGAAAASAAGGAGF
   163  180 A A  H  X S+     0   0    4   46   27  AAAGGGGAAAAAAAAAGAAAAAGAGGGGGGGGGGGAAAGGAAAAG
   164  181 A L  H  X S+     0   0    2   46   23  LLLLVNLLLLLLLLHLLLLLLLLLLLHLLLLLLLLLLLVLMVLIL
   165  182 A V  H  X S+     0   0   18   46   91  GEEAAVEEEVEDEVREQAEEEEAWIAAVGVALAYQWAWIWDDWDR
   166  183 A G  H  X S+     0   0    0   46   74  GGGSMMMMMAMGMSMMTMMMMMSTMAATLAAASAMTATGTTTTTG
   167  184 A L  H  X S+     0   0    0   46   38  LLLLMLLQLMLALLMLLLLLLLLASLVLLMLLLLAAALLLLLALL
   168  185 A T  H  X S+     0   0    0   46    8  TTTTTTTTTTTTTTVTTTTTTTTTTTLTTTTTTTTTTTTTTTTTT
   169  186 A Q  H  X S+     0   0   18   45   55  RRRQQ.KRRRRRRRQRKRRRRRLQMRRKQRRQRELQEQKKKTQRK
   170  187 A S  H  X S+     0   0    7   46   54  ASSSSKSSSTSLSGSSSSSSSSSTASTSVVSASSSTMTSAGGTGS
   171  188 A A  H  X S+     0   0    0   46   38  AAALLTLLLLLALLLLLLLLLLWMLLLLMMWLLLLMLMLLLLMLA
   172  189 A A  H  X S+     0   0    0   46   11  AAAAALAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAASSAAA
   173  190 A L  H  < S+     0   0   17   46   73  LLLILAKRLILFLQLLKLLLLLKQKMRHLKKKQKQQMLRRILQLL
   174  191 A E  H  < S+     0   0   18   46   31  EEEDEKEEEDEDEAEEEEEEEEDGDEDEEEDEEEETAAEEEETED
   175  192 A L  H ><>S+     0   0    0   45   16  LLLL.ELLLLLLLLLLLLLLLLLFLLLLLLLMLLMFLLLLVVFVL
   176  193 A A  G ><5S+     0   0    4   46   17  AAAALLAAAAAAAAAAAAAAAAAAAAAGAGAAAAGAAAAGAAAAA
   177  194 A P  G 3 5S+     0   0   77   46   22  PPPPAAPPPPPPPPPPPPPPPPPPPPPPEPPPPPPPPPAPAPPGG
   178  195 A Y  G < 5S-     0   0  133   46   76  RLLNPPQEGEHKQREHEQHQHQELDEREHDDEEDDKAKRQEYKED
   179  196 A G  T < 5S+     0   0   41   46   64  HQQVAHVIVVVGVVIVIVVVVVVGVVVVGIVVVVILIGNVGGLGR
   180  197 A I  E   < -e  137   0A   1   46   60  IIVRIVRRRRRIRRRRRRRRRRRVRRRRIRRRRRRRRIIRIIRII
   181  198 A R  E     -e  138   0A   4   44   62  RRR.RR.VVVVRVVIVVVVVVVVRVVVVTVVVVVVVVRTVRRVRR
   182  199 A V  E     +e  139   0A   0   46   65  VVVVVVVNNNNVNNNNNNNNNNNVNNNNVNNNNNNNCVVNVVNVV
   183  200 A N  E     -e  140   0A   0   46   51  NNNNNNNAAAANAAGAAAAAAAGNAGGANAGGGGGAGNNGNNANN
   184  201 A G  E     -ef 141 239A   0   46   59  AGGGGGGVVVVAIVVVIIVIVIVAVIVVAVVVIVIIVAAVGCICS
   185  202 A V  E     -ef 142 240A   0   46   63  VVIIIIIAAAAIAASAAAAAAASVASAAVSSASSAGAIVAVVGVV
   186  203 A A  E     - f   0 241A   2   45   48  AGGASASP.PPAPPPPPPPPPPPGPPPPAPPPPPPPPGAPRRPRH
   187  204 A P  E     - f   0 242A  16   46   41  PPPPPPPGPGGPGGGGGGGGGGGPGGGGPGGGGGGGGPPGPPGPP
   188  205 A G  S    S-     0   0    1   46   44  GGGGGGGAGAAGAAVAAAAAAAAGAPAPGAAAPAAPLGGAGGPGG
   189  206 A V  S    S+     0   0    1   45   66  LLLANAAIA.ILIINIIIIIIIIPIINVEIIIIIITTPFIFLTFM
   190  207 A S        -     0   0    6   46   51  SSSIIIIAIILILLILLLLLLLLALLLLILLLLLIVLAILIIVII
   191  208 A L  S    S-     0   0   59   46   65  LVVLLLLWLLWLWWFWEWWWWWWLWWWWAWWWWWWRILSWYYRHD
   192  209 A L        -     0   0    7   46   73  FLLWWWWPWWPPPPPPPPPPPPPAPPPPTPPPPPPSAPTPTTSTT
   193  210 A P        -     0   0   19   46   64  PVAppPPEPPESTEEEPQETETENDEEEPEEKEEEAASDEdeAep
   194  211 A V  S    S+     0   0  130   20   86  PDDrhE........N.......G..TNDM.G.A.....M.hh.hv
   195  212 A A  S    S+     0   0   91   23   64  ADDEAQ.NE.....H.N.....D..GGNT.E.G.....T.AA.GA
   196  213 A M  S    S-     0   0    5   39   77  MMMMSEEDEQE.QQHEVAEQEQAT.ESPGQATE....TDADS.DD
   197  214 A G     >  -     0   0   32   45   80  PPPDAAQNGQGDGASGQGGGGGAI.WLQQDEPWSNRKRADGGRGV
   198  215 A E  H  > S+     0   0  106   45   89  QPPEYIESKDKQIQSKWKKIKIIQ.QFFEMMLAQSQQQLEGGQGL
   199  216 A E  H  > S+     0   0   99   46   76  EAADWSVLPPSTADFSTDSASADGQDDDDSDPDAQSSTSNEESEG
   200  217 A E  H  > S+     0   0   71   46   66  TVVEEDSTPGAQESSAASAEAEEEEETEAEQEETNEEEDTPPEPP
   201  218 A K  H  X S+     0   0   33   46   73  QWRKQDSADEDEASHDEADADAGAWTSVDASAAEDEEEKADDEGA
   202  219 A D  H  X S+     0   0   57   46   81  EEEDEITEAQANAAQAQAAAAAYGDASYVVAESLADNQQSRRDRP
   203  220 A K  H  X S+     0   0   94   46   87  EGDKKKEAKQKFKQIKKQKKKKQFVRRRRKQRRTKFFFRHVVFVG
   204  221 A W  H  X S+     0   0   22   46   72  YHYLQSKQQQQDQQKHNQHQHQQLNRQQTQQRQDEQRADADDQAE
   205  222 A R  H >< S+     0   0   41   46   74  RRRIANAQAAAAAASANAAAAASRNHARQEAAHSSARRAERRARQ
   206  223 A R  H 3< S+     0   0  131   46   77  HSSSLLNKLILRLIDLILLLLLIESIIVLIILIIIQGQIMILQLE
   207  224 A K  H 3< S+     0   0   55   46   77  KKKSELIILMLQLLLLILLLLLLVLIEIRVLLIVIIQCAIKKIAW
   208  225 A V      -     0   0   45   46   48  SSSTGGLHGGGLGGIGGGGGGGGIGGGGGGGGGGGPSTGGGGPGG
   217  234 A A  H  > S+     0   0   13   46   71  AAAPEQGGTETGTTGTTQTTTTKESETEDANQEASGQSESREGER
   218  235 A E  H  > S+     0   0  111   46   58  AAANAAVSPPPPVPTPEVPVPVPPPPPGAPPPPPPFPPPPPPFPP
   219  236 A Q  H  > S+     0   0   45   46   53  QEEDGSEPEAEDEEPEKEEEEEEDEDDDREDEDSAGEQEQEQGVD
   220  237 A I  H >X S+     0   0    0   46   38  IVVIDDEDEDEDEDEEDEEEEEDEDDDDEDDDDDDEDEEDEEEEE
   221  238 A A  H 3X S+     0   0    0   46   44  ASSAIIDFIIIVIIEIIIIIIIIIIIIVVIIIIIIFIVVIIVFVV
   222  239 A D  H 3X S+     0   0   20   46   42  DDDKAALIAAAVAAIAVAAAAAAAAAAAAASAAAAGAAAAAAGAA
   223  240 A A  H < S+     0   0   13   46   88  FFFFVLAVRLRVLAVRIRRLRLALVSGRARAKALQRRLRSVARRR
   227  244 A L  H 3< S+     0   0    0   46   27  LLLLFFILWWWYWWLWYWWWWWFYFFFFFFFYFFFFFAFFWWFWF
   228  245 A V  H 3< S+     0   0    2   46   33  VCCALLYSLLLLLLFLILLLLLLLLLLLLLLLLLLLILLLLLLLL
   229  246 A S  S X< S-     0   0   30   46   66  PSSSAALLLALVLLLLSLLLLLLAVILIAIILIAVFVLAILLFLA
   230  247 A G  G >  S+     0   0   42   45   76  KSS.AQSADADGEsLDDDDEDECRKELQaKCCAQDDEAsHssEgs
   231  248 A S  G 3  S+     0   0   52   37   51  DKK.DEQEEGE.SeKD.DDSDSD.EDDDeDDDDN....gDes.es
   232  249 A A  G X  S+     0   0    1   46   27  AAAAAAANAAAAAASAAAAAAAAAAAAAAAAAAASTTLSAAATAA
   233  250 A Q  T <  S+     0   0   94   46   68  GKKPPPETSPSKNGSSDGSNSNPRPPHPSDPPPAPPPPGDSSPSA
   234  251 A Y  T 3  S+     0   0    4   46   34  YYYYYYYFFYFQFYYFYFFFFFFHYFYFYYFYYYYSSSYYYYSYY
   235  252 A I    <   +     0   0    1   46   18  XIIIIIIIVVVVIVIVVVVIVIVVVIIVVIIVIIIIVVIISVIVI
   236  253 A T        +     0   0    0   46    6  TTTTTTTTTSTTTTTTTTTTTTTTTTTTTTTTTTSTTTTTTTTTT
   237  254 A G  S    S+     0   0    1   46    0  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
   238  255 A S        -     0   0    2   46   56  ITTQQQQQHQHHHQQHQQHHHHQQQQHHAQQQQQQQTQQQSSQAA
   239  256 A I  E     -f  184   0A  50   46   64  TCCIIIITTVTTTVITITTTTTIMVIVVSVIVIVIMTMVIIFMFE
   240  257 A I  E     -f  185   0A   2   46   30  LVVIILLLLLLLLLILLLLLLLLILILMWIVLIIIILLIILIIIF
   241  258 A K  E     -f  186   0A  41   46   77  KKKYAAAKHAHVRHAHNRHRHRAAPAPAAASAAAAAYACPDDADA
   242  259 A V  E     +f  187   0A   2   46   20  VVVVVVVVVIVVLVIVIVVLVLVVVVVIVVVVVVILVLIVLLLLV
   243  260 A D  S >  S-     0   0    0   46   11  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDAADAD
   244  261 A G  T 3  S-     0   0    0   46    7  GGGGGGGGGGGAGGGGGGGGGGGAGGGGGGGGGGGGAGGGGGGGG
   245  262 A G  T >  S+     0   0    1   46    0  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
   246  263 A L  G X   +     0   0    0   45   57  LYYRRRKRRRRQRRRCKRRRRRRQRRRRMRRRRKRQEQMRKRQR 
   247  264 A S  G 3  S+     0   0    9   41   70  ISSGSSSSQSQRTTSQSGQTQTSHSSSS TSSSSTHHHAS  H  
   248  265 A L  G <  S+     0   0    2   39   10  LLLLLLLLLVLLL LLLLLLLLLLLIIL LLLVL LLLLV  L  
   249  266 A V    <   -     0   0   27   25   71  ATT AT TS S T TS SSTST SS V      V AMQ    A  
   250  267 A H              0   0   43   10   39  RRR                    WQ          WRW    W  
   251  268 A A              0   0   23    6   28  AAA                    A             S       
## SEQUENCE PROFILE AND ENTROPY
 SeqNo PDBNo   V   L   I   M   F   W   Y   G   A   P   S   T   C   H   R   K   Q   E   N   D  NOCC NDEL NINS ENTROPY RELENT WEIGHT
    1    2 A   0   0   0   0   0   0   0   0   0   0  14  14   0   0   0   7   7  36  14   7    14    0    0   1.767     58  0.34
    2    3 A   0   0   0   0   0   0   0   8  19   8  35  15   4   0   0   0   0   0   4   8    26    0    0   1.815     60  0.35
    3    4 A   0   0   0   0   0   0   0   0   3  42   0   0   0   0   6  50   0   0   0   0    36    0    0   0.971     32  0.47
    4    5 A  78   0   3   0   0   0   0   0   8   0   0   8   0   0   3   0   0   0   0   0    37    0    0   0.794     26  0.65
    5    6 A  25   0   7   0   0   0   0   0  68   0   0   0   0   0   0   0   0   0   0   0    44    0    0   0.791     26  0.60
    6    7 A   9  87   2   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.500     16  0.89
    7    8 A  46   0  54   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.689     23  0.86
    8    9 A   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0    46    0    0   0.000      0  1.00
    9   10 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.000      0  1.00
   10   11 A   0   0   0   0   0   0   0  37  54   0   9   0   0   0   0   0   0   0   0   0    46    0    0   0.912     30  0.67
   11   12 A   2   0   0   0   0   0   0  13  72   0  11   0   0   0   0   0   0   0   0   2    46    0    0   0.912     30  0.67
   12   13 A   2   0   0   0   0   0   0   0   2   0   2   0   0   4  48  35   7   0   0   0    46    0    0   1.284     42  0.55
   13   14 A   0   0   0   0   0   0   0  13   0   0   0   0   0   0  87   0   0   0   0   0    46    0    0   0.387     12  0.68
   14   15 A   7  17  74   0   0   0   0   0   0   0   0   0   0   0   0   0   2   0   0   0    46    0    0   0.789     26  0.78
   15   16 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.000      0  1.00
   16   17 A   0   2   0   0   0   0   0   0  59   0   2   2   0   2  24   9   0   0   0   0    46    0    0   1.200     40  0.34
   17   18 A   0   0   0   0   0   0   0   4  52   0   9   2   2   2   0   2  17   9   0   0    46    0    0   1.538     51  0.43
   18   19 A   4   2  67   7   0   0   0   0   0   0   0  15   2   0   0   0   0   2   0   0    46    0    0   1.117     37  0.59
   19   20 A  13   0   0   0   0   0   0   0  70   0   2   7   9   0   0   0   0   0   0   0    46    0    0   0.992     33  0.60
   20   21 A   7   7   4   0   0   0   0   0   0   0   0  11   4   7  35   9   0  15   2   0    46    0    0   1.997     66  0.16
   21   22 A   2  15   0   0   0   2   2   9   2   0   4  15   0  17  13   9   4   0   0   4    46    0    0   2.310     77  0.09
   22   23 A   0  93   0   0   7   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.241      8  0.97
   23   24 A   2   0   0   0   2   0   0   0  22   0   2   0   0  72   0   0   0   0   0   0    46    0    0   0.820     27  0.46
   24   25 A   0   2   0   0   0   0   0   0  41   0  11   0   0   2   7   2  22   7   4   2    46    0    0   1.764     58  0.31
   25   26 A   0   0   0   0   0   0   0   2  37   0   9   2   2  11  11   4  11   9   2   0    46    0    0   1.986     66  0.25
   26   27 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.000      0  1.00
   27   28 A   0   7   0   0  20   7  57   0   9   0   0   0   0   2   0   0   0   0   0   0    46    0    0   1.293     43  0.65
   28   29 A   0   0   0   0   0   0   0   2   9   2   4   0   7   0  35   2   2   0  24  13    46    0    0   1.835     61  0.25
   29   30 A  67  22   9   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.893     29  0.79
   30   31 A  22   2  13   4   0   0   0   4  43   0   0   0  11   0   0   0   0   0   0   0    46    0    0   1.557     51  0.36
   31   32 A  24  35  41   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   1.075     35  0.73
   32   33 A   0   0   0   0   0   0   0   2   0   0   0   2   0  87   0   0   0   0   9   0    46    0    0   0.500     16  0.77
   33   34 A   0   0   0   0   2   2  59   0  24   0   0   0   9   2   0   0   0   0   0   2    46    0    0   1.200     40  0.43
   34   35 A   2   7   0   0   0   0   2   4   0   0   4   0   2  35  35   0   0   0   9   0    46    0    0   1.647     54  0.27
   35   36 A   0   0   0   0   0   0   0   9   4   2  22   7   0   9  22   2  13   2   7   2    46    0    0   2.179     72  0.22
   36   37 A   0   0   0   0   0   0   0   2   4   0  76   0   0   0   4   0   0   7   2   4    46    0    0   0.961     32  0.63
   37   38 A   0   7   4   0   0   0   0   9  37   0   9   0   0   2   4   2   9  17   0   0    46    0    0   1.926     64  0.27
   38   39 A   0   2   0   0   0   0   0  11  28   0   7   4   0   9   4   0   2  26   0   7    46    0    0   1.956     65  0.31
   39   40 A   9   0   0   0   0   0   0   7  22   2   4   0   0   0   2   0   2  41   0  11    46    0    0   1.715     57  0.39
   40   41 A   0  20   0   2   0   0   0   0  74   0   0   0   0   0   2   0   0   2   0   0    46    0    0   0.792     26  0.56
   41   42 A   4   2   0   0   0   0   0   2   4   0   4   0   0   7  11   2  20  17   9  17    46    0    0   2.218     74  0.30
   42   43 A   2   2   2   2   0   0   0   0  41   0   9   4   0   0   7   4   7  17   0   2    46    0    0   1.927     64  0.27
   43   44 A   4  72   0   0   7   0   0   0   0   0   0   4   0   0  13   0   0   0   0   0    46    0    0   0.955     31  0.57
   44   45 A  20   7   2   0   0   0   0   0  46   0   4   0   4   2   4   4   4   2   0   0    46    0    0   1.787     59  0.29
   45   46 A   2   0   0   0   0   0   0   0  35   0   2  11   0   4   0   2  11   9   2  22    46    0    0   1.863     62  0.35
   46   47 A   0   7   0   0   0   0   0   0   9   0   2   7   0   2   4   2   4  61   0   2    46    0    0   1.476     49  0.45
   47   48 A   2  80   9   4   0   0   0   2   0   0   0   0   0   0   0   2   0   0   0   0    45    0    0   0.786     26  0.76
   48   49 A   0   2   4   0   0   0   0   0   2   0   2   2  11   0   7   0   0  20  48   2    46    0    0   1.644     54  0.29
   49   50 A   0   2   2   2   0   0   0   5  36   0  12   0   0   0  17   2  14   0   2   5    42    0    0   1.933     64  0.24
   50   51 A   4   9   9   0   0   0   0   2  20   0   0   9   0   2   9   4  26   7   0   0    46    0    0   2.136     71  0.17
   51   52 A   0   0   0   0   0   0   0   7   0   0   0   0   2   4  80   4   0   2   0   0    46    0    0   0.792     26  0.65
   52   53 A   0   2   0   2   2   0   0  17  22  39   4   2   0   0   0   0   0   7   0   2    46    0    0   1.734     57  0.35
   53   54 A   7   0   0   0   0   0   2  27   4   0   9   0   2   2   0   4   2   2  18  20    45    0    0   2.077     69  0.29
   54   55 A   2   0   4   0   0   0   0   0   2   0  70   4   0   0  11   2   2   2   0   0    46    0    0   1.182     39  0.49
   55   56 A  13   2   2   0   0   0   0   0  65   0   4   9   2   2   0   0   0   0   0   0    46    0    0   1.226     40  0.52
   56   57 A   9  22  17   0   0   2   0   0  11   0   2   9   4  11   4   2   4   0   0   2    46    0    0   2.285     76  0.14
   57   58 A  11  17   7   0   0   0   0   0  41   0   0  22   2   0   0   0   0   0   0   0    46    0    0   1.504     50  0.34
   58   59 A  15  46  11   2   7   0   0   0   2   0   0   2   7   2   0   2   2   0   0   2    46    0    0   1.824     60  0.38
   59   60 A   0   9   0   0   0   0   0   2  11   0   2   0   2  13   2   9  44   2   0   2    45    0    0   1.811     60  0.32
   60   61 A   0   0   0   0   0   0   0   9  83   0   0   2   0   0   0   4   0   0   2   0    46    0    0   0.673     22  0.76
   61   62 A   0   0   2   0   0   0   0   0   0   0   0   0   0   2   0   0   0   2   9  85    46    0    0   0.602     20  0.81
   62   63 A   2  89   2   2   0   0   0   2   2   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.519     17  0.83
   63   64 A   0   9   0   0   0   2   0   2  17   2  15  11   7   7  15   0   4   0   2   7    46    0    0   2.334     77  0.12
   64   65 A   2  13   4   0   0   0   0   0   7   0   4   0   0   0   7   2   4  13  20  24    46    0    0   2.124     70  0.22
   65   66 A   0   0   0   0   0   0   0  25   0  50  25   0   0   0   0   0   0   0   0   0     4    0    0   1.040     34  0.28
   66   67 A  33   0  17   0   0   0   0  17   0   0  17   0   0   0   0   0   0   0  17   0     6    0    0   1.561     52  0.14
   67   68 A  17   0   0   0   0   0   0   0   0   0  17  33   0  17   0   0   0   0   0  17     6    0    0   1.561     52  0.05
   68   69 A   0  67   0   0   0   0   0   0   0   0   0  17   0  17   0   0   0   0   0   0     6    0    0   0.868     28  0.22
   69   70 A   7  10  12   0   7   0   0   0   5  24   5   5   2   0   0   2   5  10   7   0    42    0    0   2.366     78  0.10
   70   71 A   0   0   0   0   0   0   0  14  30   0   7   5   0   2   0   5   5  14   2  18    44    0    0   1.990     66  0.37
   71   72 A   9   0   0   2   0   0   0   7  30   0   2   2   2   0   7   2  14  23   0   0    44    0    0   1.983     66  0.25
   72   73 A  20  24   7   0   0   0   0   2  11  20   0   7   9   0   0   0   0   0   0   0    45    0    0   1.893     63  0.23
   73   74 A   4   2   2   0   0   0   0   4  20  13   9   0   2   2   0   4   7  22   2   4    45    0    0   2.297     76  0.23
   74   75 A   0   4   0   2   0   0   0   2  22   2   4   7   0   0   7   2  24  17   2   4    46    0    0   2.159     72  0.26
   75   76 A   4  76   7   7   2   0   0   0   0   0   0   0   0   0   2   0   0   0   0   2    46    0    0   0.950     31  0.77
   76   77 A  39   2  30   0   7   0   0   2  17   0   2   0   0   0   0   0   0   0   0   0    46    0    0   1.461     48  0.48
   77   78 A   2   0   2   0   0   0   0   2  28   2   4   4   0   2   7  13   9   2   2  20    46    0    0   2.188     73  0.25
   78   79 A   0   4   2   0   0   0   2   7  15   0   2   7   2   0  17   9  13   7   2  11    46    0    0   2.397     80  0.15
   79   80 A  11   4   7   0   0   0   0   0  35   0   4   9  30   0   0   0   0   0   0   0    46    0    0   1.634     54  0.32
   80   81 A  15  17  17   0   4   0   7   2  20   0   7   0   0   0   0   4   0   2   0   4    46    0    0   2.146     71  0.19
   81   82 A   0   0   0   0   0   0   0  13  26   0   2  13   0   4  13   2   7  15   0   4    46    0    0   2.051     68  0.26
   82   83 A   4   2   2   0   0   2   0   2  33   0   2   2   0  20   9   4  11   7   0   0    46    0    0   2.088     69  0.20
   83   84 A   0  13   2   0  52  22   0   0   4   0   0   0   0   4   0   0   0   0   2   0    46    0    0   1.376     45  0.61
   84   85 A   0   0   0   0   0   0   0  91   0   0   0   0   0   0   0   2   7   0   0   0    46    0    0   0.344     11  0.85
   85   86 A   0   0   0   0   0   0   0   4   2  11   2   0   0   2  69   4   4   0   0   0    45    0    0   1.170     39  0.55
   86   87 A   7  67  17   0   0   0   0   0   0   0   0   0   9   0   0   0   0   0   0   0    46    0    0   0.961     32  0.60
   87   88 A   0   0   0   0   0   0   0   4   0   0   7   2   0   0   0   0   0   0   4  83    46    0    0   0.692     23  0.76
   88   89 A  41  15   2   0   0   0   2  15  24   0   0   0   0   0   0   0   0   0   0   0    46    0    0   1.447     48  0.39
   89   90 A  11  89   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.344     11  0.91
   90   91 A  78   0  22   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.524     17  0.91
   91   92 A   0   0   0   0   0   0   0   0   0   0   0   0   0   2   0   0   0   0  98   0    46    0    0   0.105      3  0.97
   92   93 A   0   0   0   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0  98   0    46    0    0   0.105      3  0.96
   93   94 A   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.000      0  1.00
   94   95 A   0   0   0   0   0   0   0  11   4   0  85   0   0   0   0   0   0   0   0   0    46    0    0   0.518     17  0.80
   95   96 A   9   2  11   0   0   0   0   2  20   0  24  17   0   0   4   0   0   2   7   2    46    0    0   2.066     68  0.22
   96   97 A   0   7   0   0  83   2   4   2   0   0   0   2   0   0   0   0   0   0   0   0    46    0    0   0.722     24  0.83
   97   98 A   0   2   0   0  13   0  61   0   0   0   2   2   0   2   9   2   0   7   0   0    46    0    0   1.374     45  0.39
   98   99 A   0   0   0   0   2   0   0   0   4  70   2   9   0   0   7   0   4   0   0   2    46    0    0   1.165     38  0.53
   99  100 A   0   0   0   0   0   0   0   2   2   0   2  72   0   0   0   0   7   0   2  13    46    0    0   1.015     33  0.55
  100  101 A   0   2   0   0   0   0   0   2  11  57  17   0   0   0   2   0   0   4   0   4    46    0    0   1.390     46  0.46
  101  102 A   0  13   0   0   0   0   0  25  13   0   0  25   0   0  13   0   0   0   0  13     8    0    0   1.733     57  0.10
  102  103 A  17  28  20   2   4   2   0   0   9   2   0   7   2   0   0   0   0   0   0   7    46    0    0   2.018     67  0.31
  103          0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     0    0    0   0.000      0  1.00
  104  113 A   2   2   0   0   0   0   0  46  13   0   2   0   0   7   9   0   2  11   0   7    46    0    0   1.766     58  0.33
  105  114 A   0   0   0   0   2   0   0   2   0   0   7   4   0   0   4   9  15  35   4  17    46    0    0   1.924     64  0.38
  106  115 A  17  13  13   2   9   0   0   0  30   2   0   9   2   0   0   0   0   2   0   0    46    0    0   1.955     65  0.27
  107  116 A   2   2   2   4   0   0   0   2   0   0  17  46   0   0   0   2   2   0   4  15    46    0    0   1.721     57  0.32
  108  117 A   0   9   2   0   2   0   0   2  24  15   2   0   0   0   2   0   0  39   0   2    46    0    0   1.708     56  0.27
  109  118 A   0   0   0   0   0   0   0   4  43   0   2   9   0   4   0   2   2  15   0  17    46    0    0   1.688     56  0.40
  110  119 A   0   0   0   2   0   0   0   2  15   0   7   4   0   7   7   0  33   2   2  20    46    0    0   1.974     65  0.31
  111  120 A   7   0   9   0   4  74   0   0   2   0   0   2   2   0   0   0   0   0   0   0    46    0    0   1.000     33  0.42
  112  121 A   2   0   2   2   0   0   0   0  20   0   0   2   0   2   2   2   7   7  11  41    46    0    0   1.864     62  0.36
  113  122 A   0   4   0   0   2   0   2   0  15   0   2   4   0   0   9   0   7  15   2  37    46    0    0   1.937     64  0.27
  114  123 A   9  72   9   0   0   0   0   0   0   0   0   0   0   9   0   0   0   0   2   0    46    0    0   0.959     32  0.61
  115  124 A   4  20  15  20  41   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   1.426     47  0.65
  116  125 A   0   2   0   0   0   0   0  33  30   0   2   4   0   0   2   2   2   0   9  13    46    0    0   1.758     58  0.39
  117  126 A  30   2  11   0   0   0   0   0   2   4  33  17   0   0   0   0   0   0   0   0    46    0    0   1.576     52  0.31
  118  127 A   0   0   0   0   0   0   0   0   0   0   0   0   0   4   0   0   0   0  93   2    46    0    0   0.283      9  0.91
  119  128 A  17  46   2   0   0   0   0   0  35   0   0   0   0   0   0   0   0   0   0   0    46    0    0   1.113     37  0.43
  120  129 A   4   4   7   0   0   0   0   0   4   0   0   7   0   0  30  41   2   0   0   0    46    0    0   1.576     52  0.34
  121  130 A   0   0   0   0   0   0   0  15  83   0   2   0   0   0   0   0   0   0   0   0    46    0    0   0.528     17  0.81
  122  131 A   0   0   0   0   0   0   2   0   0  91   0   4   0   0   0   0   2   0   0   0    46    0    0   0.386     12  0.81
  123  132 A   4  26   0   0  54   0   9   0   0   0   4   0   2   0   0   0   0   0   0   0    46    0    0   1.250     41  0.67
  124  133 A   4  20   4   0  67   2   0   0   0   0   0   0   0   0   0   0   0   0   2   0    46    0    0   1.024     34  0.75
  125  134 A   2  74  11   0   0   0   0   2   0   0   0   0  11   0   0   0   0   0   0   0    46    0    0   0.872     29  0.53
  126  135 A   2   2  11   4   0   0   0   4  39   0  22   4  11   0   0   0   0   0   0   0    46    0    0   1.757     58  0.31
  127  136 A   0   0   0   4   0   0   0   0   7   0   0   0   0   2  13   9  65   0   0   0    46    0    0   1.154     38  0.53
  128  137 A   2   0   0   0   0   0   0   2  72   0   4   2   0   2   4   2   0   7   0   2    46    0    0   1.188     39  0.55
  129  138 A   2  17   0   2  22   0   0   0  52   0   0   0   4   0   0   0   0   0   0   0    46    0    0   1.278     42  0.30
  130  139 A   9   7   4   0   4   0   0   0  61   0   4   7   2   0   0   2   0   0   0   0    46    0    0   1.446     48  0.42
  131  140 A   0   0   0   0   0   0   0   0  17  39   4   0   0   4   7  13   4  11   0   0    46    0    0   1.765     58  0.31
  132  141 A   4  11   0   0   0   2   2   0  15   0   0   4   0   9  17   2  22  11   0   0    46    0    0   2.140     71  0.16
  133  142 A   0   0   0   0   0   0   0   0  43  14   0   0   0   0   0  14  29   0   0   0     7    0    0   1.277     42  0.28
  134          0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     0    0    0   0.000      0  1.00
  135  152 A   2  73   2  11   0   0   0   4   2   0   2   0   0   0   0   0   0   0   0   2    45    0    0   1.033     34  0.66
  136  153 A   0   0   0   0   0   0   2  17   2   0   2   2   0   7  28  11   9   0  20   0    46    0    0   1.945     64  0.23
  137  154 A   0   4   0   0   0   0   4  89   2   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.458     15  0.73
  138  155 A   2   4   0   2   2   0   0   2  37   0  20   2  24   0   4   0   0   0   0   0    46    0    0   1.718     57  0.29
  139  156 A   7   0  91   0   0   0   0   0   2   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.344     11  0.92
  140  157 A  70   2  28   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.693     23  0.87
  141  158 A   0   0   0   0   0   0   0   2   0   0   2   0   0   0   0   0   0   0  96   0    46    0    0   0.209      6  0.93
  142  159 A   9  41  30  17   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   1.327     44  0.70
  143  160 A  17  11  17   0   0   0   0   0   9   0   9  33   4   0   0   0   0   0   0   0    46    0    0   1.776     59  0.29
  144  161 A   0   0   0   0   0   0   0   0   0   0  13   0   0   0   0   0   0   0   0  87    46    0    0   0.387     12  0.77
  145  162 A   7  22  37   4   0   0   0   0  15   0   0   4   0   0   0   0   9   2   0   0    46    0    0   1.732     57  0.32
  146  163 A   2   0   0   9   0   0  17   0   9   0   0   0   0  48   9   2   2   0   2   0    46    0    0   1.627     54  0.25
  147  164 A  15   2   4   2   0   0   0  15  39   0  11   9   0   0   0   0   0   2   0   0    46    0    0   1.780     59  0.34
  148  165 A   2   9   0   0   0   7   2   2   2   0   0   7   0   2   7   4  20  17   4  15    46    0    0   2.345     78  0.16
  149  166 A   0   2   0   0   0   2   0   7   4   0   7   2   0   0  30  11  30   0   4   0    46    0    0   1.844     61  0.28
  150  167 A   0  11   0   0   0   0   0  11   7  65   7   0   0   0   0   0   0   0   0   0    46    0    0   1.117     37  0.46
  151  168 A   0  48   4  13   4   0   0   0   0   7   2   4   0   0   4   2   0   0   9   0    46    0    0   1.721     57  0.32
  152  169 A   4   7   2   2   2   0   0   2   9  26   0   2   0   2  22  15   2   0   0   2    46    0    0   2.161     72  0.17
  153  170 A   0   0   0   0   0   0   0  30   4   0   4   0   0   2   4   2   7   9  17  20    46    0    0   1.951     65  0.40
  154  171 A   0   0   0   0  15   0  35   0   0   0   2   0   0  43   2   0   2   0   0   0    46    0    0   1.266     42  0.44
  155  172 A   9   2   4   0   7   0   4   4  13  30  20   4   2   0   0   0   0   0   0   0    46    0    0   2.049     68  0.19
  156  173 A  30  22  22   0   0   0   0   0   4   2  11   0   0   0   0   0   0   0   2   7    46    0    0   1.748     58  0.32
  157  174 A   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.000      0  1.00
  158  175 A   2   4   0   0   2   0   0  13   9   0  22  24  15   0   0   0   0   0   9   0    46    0    0   1.954     65  0.26
  159  176 A   7   9  15  15   0   0   0   0  48   0   0   2   2   0   0   0   2   0   0   0    46    0    0   1.566     52  0.35
  160  177 A   0   0   0   0   0   0   0   4  52   0  39   4   0   0   0   0   0   0   0   0    46    0    0   0.979     32  0.57
  161  178 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0    46    0    0   0.000      0  1.00
  162  179 A   0   0   0   0   4   0   0  17  54   0  20   0   0   4   0   0   0   0   0   0    46    0    0   1.227     40  0.48
  163  180 A   0   0   0   0   0   0   0  43  57   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.685     22  0.72
  164  181 A   7  83   2   2   0   0   0   0   0   0   0   0   0   4   0   0   0   0   2   0    46    0    0   0.722     24  0.77
  165  182 A  13   2   4   0   0  11   2   4  20   0   0   0   0   0   4   0   4  26   0   9    46    0    0   2.101     70  0.09
  166  183 A   0   2   0  35   0   0   0  15  17   0   9  22   0   0   0   0   0   0   0   0    46    0    0   1.585     52  0.26
  167  184 A   2  72   0   9   0   0   0   0  13   0   2   0   0   0   0   0   2   0   0   0    46    0    0   0.966     32  0.62
  168  185 A   2   2   0   0   0   0   0   0   0   0   0  96   0   0   0   0   0   0   0   0    46    0    0   0.209      6  0.92
  169  186 A   0   4   0   2   0   0   0   0   0   0   0   2   0   0  49  16  22   4   0   0    45    0    0   1.419     47  0.44
  170  187 A   4   2   0   2   0   0   0   9   9   0  59  13   0   0   0   2   0   0   0   0    46    0    0   1.389     46  0.46
  171  188 A   0  67   0  13   0   4   0   0  13   0   0   2   0   0   0   0   0   0   0   0    46    0    0   1.017     33  0.61
  172  189 A   0   2   0   0   0   0   0   0  93   0   4   0   0   0   0   0   0   0   0   0    46    0    0   0.283      9  0.88
  173  190 A   0  43   7   4   2   0   0   0   2   0   0   0   0   2   9  17  13   0   0   0    46    0    0   1.708     57  0.27
  174  191 A   0   0   0   0   0   0   0   2   7   0   0   4   0   0   0   2   0  67   0  17    46    0    0   1.051     35  0.68
  175  192 A   7  80   0   4   7   0   0   0   0   0   0   0   0   0   0   0   0   2   0   0    45    0    0   0.763     25  0.84
  176  193 A   0   4   0   0   0   0   0   9  87   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.470     15  0.83
  177  194 A   0   0   0   0   0   0   0   4   9  85   0   0   0   0   0   0   0   2   0   0    46    0    0   0.572     19  0.77
  178  195 A   0   7   0   0   0   0   4   2   2   4   0   0   0  11   9   9  13  24   2  13    46    0    0   2.240     74  0.24
  179  196 A  50   4  13   0   0   0   0  17   2   0   0   0   0   4   2   0   4   0   2   0    46    0    0   1.575     52  0.35
  180  197 A   7   0  26   0   0   0   0   0   0   0   0   0   0   0  67   0   0   0   0   0    46    0    0   0.795     26  0.40
  181  198 A  64   0   2   0   0   0   0   0   0   0   0   5   0   0  30   0   0   0   0   0    44    0    0   0.874     29  0.37
  182  199 A  37   0   0   0   0   0   0   0   0   0   0   0   2   0   0   0   0   0  61   0    46    0    0   0.753     25  0.35
  183  200 A   0   0   0   0   0   0   0  24  39   0   0   0   0   0   0   0   0   0  37   0    46    0    0   1.077     35  0.48
  184  201 A  41   0  22   0   0   0   0  17  13   0   2   0   4   0   0   0   0   0   0   0    46    0    0   1.486     49  0.40
  185  202 A  22   0  15   0   0   0   0   4  43   0  15   0   0   0   0   0   0   0   0   0    46    0    0   1.403     46  0.36
  186  203 A   0   0   0   0   0   0   0   9  16  62   4   0   0   2   7   0   0   0   0   0    45    0    0   1.203     40  0.51
  187  204 A   0   0   0   0   0   0   0  61   0  39   0   0   0   0   0   0   0   0   0   0    46    0    0   0.669     22  0.58
  188  205 A   2   2   0   0   0   0   0  39  46  11   0   0   0   0   0   0   0   0   0   0    46    0    0   1.133     37  0.56
  189  206 A   4  11  47   2   7   0   0   0   9   4   0   7   0   0   0   0   0   2   7   0    45    0    0   1.802     60  0.33
  190  207 A   4  48  33   0   0   0   0   0   7   0   9   0   0   0   0   0   0   0   0   0    46    0    0   1.245     41  0.49
  191  208 A   4  24   2   0   2  48   4   0   2   0   2   0   0   2   4   0   0   2   0   2    46    0    0   1.686     56  0.35
  192  209 A   0   7   0   0   2  13   0   0   4  57   4  13   0   0   0   0   0   0   0   0    46    0    0   1.388     46  0.26
  193  210 A   2   0   0   0   0   0   0   0   9  24   4   7   0   0   0   2   2  41   2   7    46    0    0   1.745     58  0.36
  194  211 A  10   0   0  10   0   0   0  10   5   5   0   5   0  20   5   0   0   5  10  15    20    0    0   2.276     75  0.13
  195  212 A   0   0   0   0   0   0   0  17  26   0   0   9   0   4   0   0   4  13  13  13    23    0    0   1.937     64  0.35
  196  213 A   3   0   0  13   0   0   0   3  10   3   8   8   0   3   0   0  15  23   0  13    39    0    0   2.157     72  0.23
  197  214 A   2   2   2   0   0   4   0  29  11   9   4   0   0   0   7   2  11   2   4   9    45    0    0   2.296     76  0.20
  198  215 A   0   7  11   4   4   2   2   7   2   4   7   0   0   0   0  13  22  11   0   2    45    0    0   2.386     79  0.10
  199  216 A   2   2   0   0   2   2   0   4  13   7  22   7   0   0   0   0   4  11   2  22    46    0    0   2.215     73  0.24
  200  217 A   4   0   0   0   0   0   0   2  13  11   9  11   0   0   0   0   4  39   2   4    46    0    0   1.903     63  0.33
  201  218 A   2   0   0   0   0   4   0   4  24   0   9   2   0   2   2   7   4  17   0  22    46    0    0   2.110     70  0.27
  202  219 A   4   2   2   0   0   0   4   2  28   2   7   2   0   0   7   0  11  13   4  11    46    0    0   2.286     76  0.19
  203  220 A   9   0   2   0  13   0   0   4   2   0   0   2   0   2  15  33  11   4   0   2    46    0    0   2.060     68  0.12
  204  221 A   0   4   0   0   0   2   4   0   7   0   2   2   0   9   7   4  39   4   4  11    46    0    0   2.108     70  0.27
  205  222 A   0   0   2   0   0   0   0   0  43   0   9   0   0   4  24   0   7   4   7   0    46    0    0   1.629     54  0.25
  206  223 A   2  33  28   2   0   0   0   2   0   0   9   0   0   2   4   2   7   4   2   2    46    0    0   1.968     65  0.22
  207  224 A   7  35  22   2   0   2   0   0   4   0   2   0   2   0   2  13   4   4   0   0    46    0    0   1.968     65  0.22
  208  225 A   9   2   7   0   0   0   0   0  35   7   9   2   0   0   0   4   4   9   2  11    46    0    0   2.124     70  0.24
  209  226 A   0   2   0   0   0   0   0   9   4  11   9   2   0   0  39   7   9   2   2   4    46    0    0   2.029     67  0.25
  210  227 A   9  24  17   0   0   0   0   0   0   0   2  43   0   0   0   4   0   0   0   0    46    0    0   1.440     48  0.35
  211  228 A   2   9   7   0   0   0   4   7   7  63   0   2   0   0   0   0   0   0   0   0    46    0    0   1.340     44  0.39
  212  229 A   0  65   0  15   0   0   0   0   4   4   0   0   0   0   2   0   7   2   0   0    46    0    0   1.182     39  0.56
  213  230 A   0   9   0   0   0   0   0  17  28   0   2   0   0   0  15  17   9   2   0   0    46    0    0   1.843     61  0.19
  214  231 A   0   0   0   0   0   0   0   4   7   0   0   0   0   2  69   4   2   7   0   4    45    0    0   1.202     40  0.49
  215  232 A   2   2  17   4   2   0   0  20   7   4   7  15   2   0   7   0   4   4   2   0    46    0    0   2.405     80  0.14
  216  233 A   0   4   4   0   0   0   0  70   0   4  11   4   0   2   0   0   0   0   0   0    46    0    0   1.122     37  0.52
  217  234 A   0   0   0   0   0   0   0  13  13   2   9  24   0   0   4   2   9  20   2   2    46    0    0   2.087     69  0.28
  218  235 A  11   0   0   0   4   0   0   2  13  59   2   2   0   0   0   0   0   4   2   0    46    0    0   1.425     47  0.42
  219  236 A   2   0   0   0   0   0   0   7   4   4   4   0   0   0   2   2  11  43   0  20    46    0    0   1.759     58  0.47
  220  237 A   4   0   7   0   0   0   0   0   0   0   0   0   0   0   0   0   0  46   0  43    46    0    0   1.034     34  0.62
  221  238 A  17   0  61   0   7   0   0   0   7   0   4   0   0   0   0   0   0   2   0   2    46    0    0   1.265     42  0.55
  222  239 A   4   2   4   0   0   0   0   4  72   0   2   0   0   0   0   2   0   0   0   9    46    0    0   1.109     37  0.57
  223  240 A   7   0   0   0   0   0   0   2  22   0   2   2   0   0  17   9   2  33   2   2    46    0    0   1.891     63  0.25
  224  241 A   9   7   2   0   0   0   0   0  57   0   0  20   0   0   0   0   7   0   0   0    46    0    0   1.293     43  0.42
  225  242 A  57   0  28   0   0   0   0   0  13   0   2   0   0   0   0   0   0   0   0   0    46    0    0   1.029     34  0.65
  226  243 A  13  17   2   0  11   0   0   2  15   0   4   0   0   0  30   2   2   0   0   0    46    0    0   1.929     64  0.12
  227  244 A   0  15   2   0  41  30   9   0   2   0   0   0   0   0   0   0   0   0   0   0    46    0    0   1.393     46  0.73
  228  245 A   4  78   4   0   2   0   2   0   2   0   2   0   4   0   0   0   0   0   0   0    46    0    0   0.934     31  0.66
  229  246 A   9  43  13   0   4   0   0   0  17   2  11   0   0   0   0   0   0   0   0   0    46    0    0   1.605     53  0.34
  230  247 A   0   4   0   0   0   0   0   7  13   0  18   0   7   2   2   7   7  13   0  20    45    0    0   2.196     73  0.23
  231  248 A   0   0   0   0   0   0   0   5   0   0  16   0   0   0   0   8   3  24   3  41    37    0    0   1.561     52  0.48
  232  249 A   0   2   0   0   0   0   0   0  83   0   7   7   0   0   0   0   0   0   2   0    46    0    0   0.680     22  0.73
  233  250 A   0   0   0   0   0   0   0   9   4  35  22   2   0   2   2   7   2   2   7   7    46    0    0   1.998     66  0.32
  234  251 A   0   0   0   0  30   0  57   0   0   0   9   0   0   2   0   0   2   0   0   0    46    0    0   1.063     35  0.65
  235  252 A  43   0  52   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0   0    46    0    0   0.785     26  0.81
  236  253 A   0   0   0   0   0   0   0   0   0   0   4  96   0   0   0   0   0   0   0   0    46    0    0   0.179      5  0.93
  237  254 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.000      0  1.00
  238  255 A   0   0   2   0   0   0   0   0   7   0   7   7   0  24   0   0  54   0   0   0    46    0    0   1.291     43  0.43
  239  256 A  20   0  30   9   4   0   0   0   0   0   2  28   4   0   0   0   0   2   0   0    46    0    0   1.690     56  0.36
  240  257 A   7  52  35   2   2   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   1.134     37  0.70
  241  258 A   2   0   0   0   0   0   4   0  41   7   2   0   2  13   9  11   0   0   2   7    46    0    0   1.910     63  0.22
  242  259 A  67  20  13   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.851     28  0.79
  243  260 A   0   0   0   0   0   0   0   0   7   0   0   0   0   0   0   0   0   0   0  93    46    0    0   0.241      8  0.88
  244  261 A   0   0   0   0   0   0   0  93   7   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.241      8  0.93
  245  262 A   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0    46    0    0   0.000      0  1.00
  246  263 A   0   4   0   4   0   0   4   0   0   0   0   0   2   0  62   9  11   2   0   0    45    0    0   1.339     44  0.42
  247  264 A   0   0   2   0   0   0   0   5   2   0  49  15   0  12   2   0  12   0   0   0    41    0    0   1.564     52  0.30
  248  265 A   8  87   5   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    39    0    0   0.469     15  0.89
  249  266 A  12   0   0   4   0   0   0   0  16   0  32  32   0   0   0   0   4   0   0   0    25    0    0   1.534     51  0.28
  250  267 A   0   0   0   0   0  40   0   0   0   0   0   0   0  10  40   0  10   0   0   0    10    0    0   1.194     39  0.60
  251  268 A   0   0   0   0   0   0   0   0  83   0  17   0   0   0   0   0   0   0   0   0     6    0    0   0.451     15  0.71
## INSERTION LIST
 AliNo  IPOS  JPOS   Len Sequence
     1   101   110    10 pLLPGDDTNGAa
     1   134   153     8 gEGGAWRSRn
     2    63    69    13 nVATAPVSGADGSAp
     2    99   118    13 pLLRNDEDGHEPCVg
     2   130   162     1 rFa
     2   132   165     8 gTPAKHRGTn
     3    63    69    13 nVAKAPVSGADGSAp
     3    99   118    13 pLLRSDEDGHEPCVg
     3   130   162     1 rVa
     3   132   165     8 dTPAEQRGTn
     4   125   130     1 aLa
     4   127   133     1 vSk
     4   184   191     1 pEr
     5   126   132     3 lRNSa
     5   183   192     1 pNh
     6   127   132     3 lRESq
     7   124   131     3 lRESn
     8   128   135     3 lAPCk
     9   125   131     3 lRQQr
    10   127   132     1 wLk
    10   129   135     1 aSr
    11   127   131     3 lRQRr
    12    80    82     1 gGp
    12   126   129     1 qDp
    12   128   132     2 lPDg
    13   127   131     3 lRKHr
    14   126   131     3 lRQSg
    14   219   227     1 sAe
    15    96   100     2 dLNd
    15   128   134     3 lKKSh
    15   141   150     1 dAk
    16   127   131     3 lRQRr
    17   127   128     3 lKKRk
    18   128   130     3 lRAHr
    19   127   131     3 lRQRr
    20   127   131     3 lRKHr
    21   127   131     3 lRQRr
    22   127   131     3 lRKHr
    23   128   131     3 lKLSq
    24   127   135     5 tAPRGAn
    25   129   141     3 lKATk
    26   126   129     3 lKKNr
    27   127   132     3 lQQAn
    28   128   133     3 lRKNs
    29    49    61     2 rALg
    29   125   139     5 mIRQGGg
    29   220   239     1 aPe
    30   124   128     3 lSARr
    31   128   131     3 lRRNr
    32   126   129     3 lKRRg
    33   128   129     3 lRKQh
    34   123   124     3 lKKTk
    35   121   126     3 lSRNn
    36   123   131     4 lPDDTt
    37   123   131     3 iGGRq
    38    79    99     1 gGp
    38   126   147     4 lPETAq
    39    35    46     2 gLAd
    39   124   137     4 mMKQRy
    39   219   236     1 sSg
    40   126   134     3 lAQRh
    41   128   132     7 mAKRHGGSg
    41   141   152     1 rSg
    41   186   198     1 dMh
    41   223   236     1 sEe
    42   126   128     7 mSKKHGGQg
    42   139   148     1 rLg
    42   184   194     1 eIh
    42   221   232     1 sDs
    43   123   131     4 lPDDAn
    44   127   128     7 mSHRHGGRg
    44   140   148     1 rLg
    44   185   194     1 eMh
    44   222   232     1 gDe
    45   123   131     4 lRNAGg
    45   181   193     1 pMv
    45   218   231     1 sDs
//